PDB entry 1i4z

View 1i4z on RCSB PDB site
Description: the crystal structure of phascolopsis gouldii l98y methemerythrin
Class: oxygen storage/transport
Keywords: hemerythrin, oxygen binding, diiron, mutation, four-helix bundle, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2001-02-23, released 2001-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.248
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02244 (Start-113)
      • engineered (98)
    Domains in SCOPe 2.08: d1i4za_
  • Chain 'B':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02244 (Start-113)
      • engineered (98)
    Domains in SCOPe 2.08: d1i4zb_
  • Chain 'C':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02244 (Start-113)
      • engineered (98)
    Domains in SCOPe 2.08: d1i4zc_
  • Chain 'D':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02244 (Start-113)
      • engineered (98)
    Domains in SCOPe 2.08: d1i4zd_
  • Chain 'E':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02244 (Start-113)
      • engineered (98)
    Domains in SCOPe 2.08: d1i4ze_
  • Chain 'F':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02244 (Start-113)
      • engineered (98)
    Domains in SCOPe 2.08: d1i4zf_
  • Chain 'G':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02244 (Start-113)
      • engineered (98)
    Domains in SCOPe 2.08: d1i4zg_
  • Chain 'H':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02244 (Start-113)
      • engineered (98)
    Domains in SCOPe 2.08: d1i4zh_
  • Heterogens: FEO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i4zA (A:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4zA (A:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i4zB (B:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4zB (B:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i4zC (C:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4zC (C:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i4zD (D:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4zD (D:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1i4zE (E:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4zE (E:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1i4zF (F:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4zF (F:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1i4zG (G:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4zG (G:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1i4zH (H:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4zH (H:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswyvnhiktidfkykgki