PDB entry 1i4y

View 1i4y on RCSB PDB site
Description: the crystal structure of phascolopsis gouldii wild type methemerythrin
Class: oxygen storage/transport
Keywords: hemerythrin, oxygen binding, diiron, four-helix bundle, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2001-02-23, released 2001-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.224
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i4ya_
  • Chain 'B':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i4yb_
  • Chain 'C':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i4yc_
  • Chain 'D':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i4yd_
  • Chain 'E':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i4ye_
  • Chain 'F':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i4yf_
  • Chain 'G':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i4yg_
  • Chain 'H':
    Compound: methemerythrin
    Species: Phascolopsis gouldii [TaxId:6442]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i4yh_
  • Heterogens: CL, FEO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i4yA (A:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4yA (A:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i4yB (B:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4yB (B:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i4yC (C:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4yC (C:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i4yD (D:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4yD (D:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1i4yE (E:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4yE (E:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1i4yF (F:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4yF (F:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1i4yG (G:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4yG (G:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1i4yH (H:)
    mgfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneq
    vlmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4yH (H:)
    gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
    lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki