PDB entry 1i4v

View 1i4v on RCSB PDB site
Description: solution structure of the umud' homodimer
Class: hydrolase
Keywords: SOS response, SOS mutagenesis, DNA repair, DNA polymerase V, DNA polymerase accessory protein, LexA repressor, lambda CI, signal peptidase, serine-lysine dyad, autocatalytic cleavage, serine protease, HYDROLASE
Deposited on 2001-02-23, released 2001-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: umud' protein
    Species: Escherichia coli [TaxId:562]
    Gene: UMUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04153 (0-114)
      • engineered (0)
    Domains in SCOPe 2.07: d1i4va_
  • Chain 'B':
    Compound: umud' protein
    Species: Escherichia coli [TaxId:562]
    Gene: UMUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04153 (0-114)
      • engineered (0)
    Domains in SCOPe 2.07: d1i4vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i4vA (A:)
afpspaadyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgd
iviaavdgeftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkamr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i4vB (B:)
afpspaadyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgd
iviaavdgeftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkamr