PDB entry 1i4s

View 1i4s on RCSB PDB site
Description: crystal structure of RNAse III endonuclease domain from aquifex aeolicus at 2.15 angstrom resolution
Class: hydrolase
Keywords: ribonuclease, RNAse III, double-stranded RNA, catalytic domain, endonuclease domain, endonucleolytic cleavage
Deposited on 2001-02-22, released 2001-12-19
The last revision prior to the SCOP 1.73 freeze date was dated 2001-12-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.222
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1i4sa_
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1i4sb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4sA (A:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4sB (B:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegr