PDB entry 1i4n

View 1i4n on RCSB PDB site
Description: crystal structure of indoleglycerol phosphate synthase from thermotoga maritima
Class: lyase
Keywords: Indoleglycerol phosphate synthase; Thermotoga maritima; Thermostable TIM-barrel protein; Salt bridges; Electrostatic interactions, LYASE
Deposited on 2001-02-22, released 2002-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.169
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: indole-3-glycerol phosphate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i4na_
  • Chain 'B':
    Compound: indole-3-glycerol phosphate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i4nb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4nA (A:)
    rrlweiveakkkdileidgenlivqrrnhrflevlsgkervkiiaefkkaspsagdinad
    asledfirmydeladaisiltekhyfkgdpafvraarnltcrpilakdfyidtvqvklas
    svgadailiiariltaeqikeiyeaaeelgmdslvevhsredlekvfsvirpkiigintr
    dldtfeikknvlwellplvpddtvvvaesgikdprelkdlrgkvnavlvgtsimkaenpr
    rfleemrawse
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4nB (B:)
    rrlweiveakkkdileidgenlivqrrnhrflevlsgkervkiiaefkkaspsagdinad
    asledfirmydeladaisiltekhyfkgdpafvraarnltcrpilakdfyidtvqvklas
    svgadailiiariltaeqikeiyeaaeelgmdslvevhsredlekvfsvirpkiigintr
    dldtfeikknvlwellplvpddtvvvaesgikdprelkdlrgkvnavlvgtsimkaenpr
    rfleemrawse