PDB entry 1i4m

View 1i4m on RCSB PDB site
Description: Crystal structure of the human prion protein reveals a mechanism for oligomerization
Class: membrane protein
Keywords: domain-swapped dimer
Deposited on 2001-02-22, released 2002-02-27
The last revision prior to the SCOP 1.73 freeze date was dated 2002-03-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04156 (0-107)
  Domains in SCOP 1.73: d1i4ma_
• Heterogens: CD, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i4mA (A:)
  gavvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhd
  cvnitikqhtvttttkgenftetdvkmmervveqmcitqyeresqayy