PDB entry 1i4l

View 1i4l on RCSB PDB site
Description: crystal structure analysis of rac1-gdp in complex with arfaptin (p41)
Deposited on 2001-02-22, released 2001-05-16
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-16, with a file datestamp of 2001-05-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.258
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1i4la_
  • Chain 'B':
    Domains in SCOP 1.57: d1i4lb_
  • Chain 'D':
    Domains in SCOP 1.57: d1i4ld_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4lD (D:)
    qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagq
    edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
    dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc