PDB entry 1i4j

View 1i4j on RCSB PDB site
Description: crystal structure of l22 ribosomal protein mutant
Class: RNA binding protein
Keywords: Ribosomal Protein, Mutant, Erythromycin Resistance, RNA binding, Crystal Structure
Deposited on 2001-02-22, released 2002-09-11
The last revision prior to the SCOP 1.73 freeze date was dated 2002-09-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus
    Gene: RPL22
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1i4ja_
  • Chain 'B':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus
    Gene: RPL22
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1i4jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4jA (A:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdaledrlyvkaayvdegpavlprargradiikkrtshitvilgekhgk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4jB (B:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdaledrlyvkaayvdegpavlprargradiikkrtshitvilgekhgk