PDB entry 1i4j
View 1i4j on RCSB PDB site
Description: crystal structure of l22 ribosomal protein mutant
Class: RNA binding protein
Keywords: Ribosomal Protein, Mutant, Erythromycin Resistance, RNA binding, Crystal Structure
Deposited on
2001-02-22, released
2002-09-11
The last revision prior to the SCOP 1.73 freeze date was dated
2002-09-11, with a file datestamp of
2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.49
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 50S ribosomal protein L22
Species: Thermus thermophilus
Gene: RPL22
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1i4ja_ - Chain 'B':
Compound: 50S ribosomal protein L22
Species: Thermus thermophilus
Gene: RPL22
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1i4jb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1i4jA (A:)
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdaledrlyvkaayvdegpavlprargradiikkrtshitvilgekhgk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1i4jB (B:)
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdaledrlyvkaayvdegpavlprargradiikkrtshitvilgekhgk