PDB entry 1i4g

View 1i4g on RCSB PDB site
Description: Crystal structure of Staphylococcal enterotoxin A mutant H187A with reduced Zn2+ affinity
Class: toxin
Keywords: beta-grasp, beta-barrel, TOXIN
Deposited on 2001-02-21, released 2001-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterotoxin type a
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L2 (Start-232)
      • engineered (186)
    Domains in SCOPe 2.06: d1i4ga1, d1i4ga2
  • Chain 'B':
    Compound: enterotoxin type a
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L2 (Start-232)
      • engineered (186)
    Domains in SCOPe 2.06: d1i4gb1, d1i4gb2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i4gA (A:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4gA (A:)
    kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
    dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekkvpinl
    wldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfats
    tepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i4gB (B:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4gB (B:)
    nekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndl
    lvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekkvpi
    nlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfa
    tstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts