PDB entry 1i4e

View 1i4e on RCSB PDB site
Description: crystal structure of the caspase-8/p35 complex
Class: apoptosis/hydrolase
Keywords: covalent complex protease-inhibitor, APOPTOSIS-HYDROLASE COMPLEX
Deposited on 2001-02-20, released 2001-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.236
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Early 35 kDa protein
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Gene: P35
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i4ea_
  • Chain 'B':
    Compound: caspase-8
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP8, MCH5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14790 (0-257)
      • see remark 999 (63)
    Domains in SCOPe 2.07: d1i4eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i4eA (A:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4eA (A:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdikyfkdehysvscqngsvlkskfakilkshdytd
    kksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivpfahei
    ndtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksmiykal
    efttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i4eB (B:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetdseeqpylemdlsspqtryipdeadfll
    gmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgk
    qmpqptftlrkklvfpsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4eB (B:)
    ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
    kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
    glkcpslagkpkvffiqacqgdnyqkgipvetdtryipdeadfllgmatvnncvsyrnpa
    egtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgkqmpqptftlrkklvf
    psd