PDB entry 1i45

View 1i45 on RCSB PDB site
Description: yeast triosephosphate isomerase (mutant)
Class: Isomerase
Keywords: TRIOSEPHOSPHATE ISOMERASE, mutant, yeast, 5'-fluorotryptophan
Deposited on 2001-02-19, released 2001-06-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00942 (1-247)
      • engineered (89)
      • engineered (156)
      • modified residue (167)
    Domains in SCOPe 2.01: d1i45a_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00942 (1-247)
      • engineered (89)
      • engineered (156)
      • modified residue (167)
    Domains in SCOPe 2.01: d1i45b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i45A (A:)
    martffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvt
    vgaqnaylkasgaftgensvdqikdvgakyvilghserrsyfheddkfiadktkfalgqg
    vgvilcigetleekkagktldvverqlnavleevkdftnvvvayepvwaigtglaatped
    aqdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpef
    vdiinsrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i45A (A:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakyvilghserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdftnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i45B (B:)
    martffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvt
    vgaqnaylkasgaftgensvdqikdvgakyvilghserrsyfheddkfiadktkfalgqg
    vgvilcigetleekkagktldvverqlnavleevkdftnvvvayepvwaigtglaatped
    aqdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpef
    vdiinsrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i45B (B:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakyvilghserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdftnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn