PDB entry 1i44

View 1i44 on RCSB PDB site
Description: crystallographic studies of an activation loop mutant of the insulin receptor tyrosine kinase
Deposited on 2001-02-19, released 2001-03-07
The last revision prior to the SCOP 1.67 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1i44a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i44A (A:)
    vfpssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetayyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i44A (A:)
    pdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefl
    neasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrpppt
    lqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtlpvrwmapesl
    kdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdggyldqpdncpervtdl
    mrmcwqfnpkmrptfleivnllkddlhpsfpevsffhseenk