PDB entry 1i42

View 1i42 on RCSB PDB site
Description: nmr structure of the ubx domain from p47
Class: protein binding
Keywords: Ubiquitin superfold, UBX, unusual N-terminal feature, PROTEIN BINDING
Deposited on 2001-02-19, released 2001-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: p47
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O35987 (0-88)
  Domains in SCOPe 2.04: d1i42a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i42A (A:)
  kasssilineaepttniqirladggrlvqkfnhshrisdirlfivdarpamaatsfvlmt
  tfpnkeladenqtlkeanllnavivqrlt