PDB entry 1i40

View 1i40 on RCSB PDB site
Description: structure of inorganic pyrophosphatase
Class: hydrolase
Keywords: hydrolase, inorganic pyrophosphatase
Deposited on 2001-02-19, released 2001-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.117
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7A9 (0-174)
      • see remark 999 (84)
    Domains in SCOPe 2.07: d1i40a_
  • Heterogens: NA, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i40A (A:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvtrcrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk