PDB entry 1i3z

View 1i3z on RCSB PDB site
Description: murine eat2 sh2 domain in complex with slam phosphopeptide
Class: signaling protein
Keywords: SH2 domain Phosphotyrosine signal transduction lymphocyte, SIGNALING PROTEIN
Deposited on 2001-02-19, released 2003-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ews/fli1 activated transcript 2
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O35324 (0-102)
  Domains in SCOPe 2.07: d1i3za_
• Chain 'B':
  Compound: signaling lymphocytic activation molecule
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • GB CAC00576 (Start-13)
    • modified residue (8)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i3zA (A:)
  mdlpyyhgcltkrecealllkggvdgnflirdsesvpgalclcvsfkklvysyrifrekh
  gyyrietdahtprtifpnlqelvskygkpgqglvvhlsnpimr
  

  
  
• Chain 'B':
  No sequence available.