PDB entry 1i3v

View 1i3v on RCSB PDB site
Description: three-dimensional structure of a lama vhh domain unliganded
Class: immune system
Keywords: antibody, domain VHH, Lama, IMMUNE SYSTEM
Deposited on 2001-02-16, released 2001-08-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.212
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody vhh lama domain
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 1I3V (0-128)
    Domains in SCOPe 2.03: d1i3va_
  • Chain 'B':
    Compound: antibody vhh lama domain
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 1I3V (0-128)
    Domains in SCOPe 2.03: d1i3vb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i3vA (A:)
qvqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsd
fytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywg
qgtqvtvss

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i3vB (B:)
qvqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsd
fytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywg
qgtqvtvss