PDB entry 1i3u

View 1i3u on RCSB PDB site
Description: three-dimensional structure of a llama vhh domain complexed with the dye rr1
Deposited on 2001-02-16, released 2001-08-08
The last revision prior to the SCOP 1.63 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.232
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1i3ua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i3uA (A:)
  vqlqesggglvqagdslklsceasgdsigtyvigwfrqapgkeriylatigrnlvgpsdf
  ytryadsvkgrfavsrdnakntvnlqmnslkpedtavyycaaktttwggndpnnwnywgq
  gtqvtv