PDB entry 1i3r

View 1i3r on RCSB PDB site
Description: crystal structure of a mutant iek class II MHC molecule
Class: immune system
Keywords: MHC ClassII, IMMUNE SYSTEM
Deposited on 2001-02-15, released 2001-06-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: IEK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04224 (0-End)
      • engineered (10)
      • engineered (65)
    Domains in SCOPe 2.03: d1i3ra1, d1i3ra2
  • Chain 'B':
    Compound: fusion protein consisting of MHC e-beta-k precursor, glycine rich linker, and hemoglobin beta-2 chain
    Species: Mus musculus [TaxId:10090]
    Gene: IEK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02089 (4-16)
      • linker (17-31)
    • GB AAA39593 (32-End)
    Domains in SCOPe 2.03: d1i3rb1, d1i3rb2
  • Chain 'C':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: IEK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04224 (0-End)
      • engineered (10)
      • engineered (65)
    Domains in SCOPe 2.03: d1i3rc1, d1i3rc2
  • Chain 'D':
    Compound: fusion protein consisting of MHC e-beta-k precursor, glycine rich linker, and hemoglobin beta-2 chain
    Species: Mus musculus [TaxId:10090]
    Gene: IEK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02089 (4-16)
      • linker (17-31)
    • GB AAA39593 (32-End)
    Domains in SCOPe 2.03: d1i3rd1, d1i3rd2
  • Chain 'E':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: IEK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04224 (0-End)
      • engineered (10)
      • engineered (65)
    Domains in SCOPe 2.03: d1i3re1, d1i3re2
  • Chain 'F':
    Compound: fusion protein consisting of MHC e-beta-k precursor, glycine rich linker, and hemoglobin beta-2 chain
    Species: Mus musculus [TaxId:10090]
    Gene: IEK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02089 (4-16)
      • linker (17-31)
    • GB AAA39593 (32-End)
    Domains in SCOPe 2.03: d1i3rf1, d1i3rf2
  • Chain 'G':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: IEK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04224 (0-End)
      • engineered (10)
      • engineered (65)
    Domains in SCOPe 2.03: d1i3rg1, d1i3rg2
  • Chain 'H':
    Compound: fusion protein consisting of MHC e-beta-k precursor, glycine rich linker, and hemoglobin beta-2 chain
    Species: Mus musculus [TaxId:10090]
    Gene: IEK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02089 (4-16)
      • linker (17-31)
    • GB AAA39593 (32-End)
    Domains in SCOPe 2.03: d1i3rh1, d1i3rh2
  • Heterogens: NAG, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i3rA (A:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rA (A:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i3rB (B:)
    rdsrgkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvry
    fynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnfl
    vprrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrn
    gdwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rB (B:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i3rC (C:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rC (C:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i3rD (D:)
    rdsrgkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvry
    fynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnfl
    vprrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrn
    gdwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rD (D:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1i3rE (E:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rE (E:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1i3rF (F:)
    rdsrgkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvry
    fynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnfl
    vprrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrn
    gdwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rF (F:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1i3rG (G:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rG (G:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1i3rH (H:)
    rdsrgkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvry
    fynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnfl
    vprrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrn
    gdwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rH (H:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka