PDB entry 1i3j
View 1i3j on RCSB PDB site
Description: crystal structure of the DNA-binding domain of intron endonuclease I-tevi with its substrate
Class: hydrolase/DNA
Keywords: protein-DNA complex, extended structure, zn-finger, minor groove helix, helix-turn-helix, hydrolase/DNA complex
Deposited on
2001-02-15, released
2001-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.215
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: intron-associated endonuclease 1
Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1i3ja_ - Chain 'B':
Compound: 5'-d(*tp*tp*cp*tp*tp*gp*gp*gp*tp*cp*tp*ap*cp*cp*gp*tp*tp*tp*ap*ap*t)-3'
- Chain 'C':
Compound: 5'-d(*ap*ap*tp*tp*ap*ap*ap*cp*gp*gp*tp*ap*gp*ap*cp*cp*cp*ap*ap*gp*a)-3'
- Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1i3jA (A:)
kalyskpgskngrwnpethkfckcgvriqtsaytcskcrnrsgennsffnhkhsditksk
isekmkgkkpsnikkiscdgvifdcaadaarhfkissglvtyrvksdkwnwfyina
Sequence, based on observed residues (ATOM records): (download)
>1i3jA (A:)
kfckcgvriqtsaytcskcrnrsgennsffnhkhsditkskisekmkgkkpsnikkiscd
gvifdcaadaarhfkissglvtyrvksdkwnwfyin
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.