PDB entry 1i3i

View 1i3i on RCSB PDB site
Description: ribonuclease t1 v78t mutant
Deposited on 2001-02-15, released 2001-03-07
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-07, with a file datestamp of 2001-03-07.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1i3ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i3iA (A:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrtvfnennqlagvithtgasgnnfvect