PDB entry 1i3h

View 1i3h on RCSB PDB site
Description: concanavalin a-dimannose structure
Class: sugar binding protein
Keywords: Concanavalin A, Protein-Sugar Complex, Sugar Binding Protein
Deposited on 2001-02-15, released 2001-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i3ha_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i3hA (A:)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan