PDB entry 1i3e

View 1i3e on RCSB PDB site
Description: human azido-met hemoglobin bart's (gamma4)
Deposited on 2001-02-15, released 2001-09-12
The last revision prior to the SCOP 1.63 freeze date was dated 2001-09-12, with a file datestamp of 2001-09-12.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.184
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1i3ea_
  • Chain 'B':
    Domains in SCOP 1.63: d1i3eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3eA (A:)
    ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
    kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
    eftpevqaswqkmvtavasalssryh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3eB (B:)
    ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
    kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
    eftpevqaswqkmvtavasalssryh