PDB entry 1i3d

View 1i3d on RCSB PDB site
Description:
Deposited on 2001-02-15, released 2001-09-12
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-12, with a file datestamp of 2001-09-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.211
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1i3da_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1i3db_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3dA (A:)
    ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
    kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
    eftpevqaswqkmvtavasalssryh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3dB (B:)
    ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
    kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
    eftpevqaswqkmvtavasalssryh