PDB entry 1i3a

View 1i3a on RCSB PDB site
Description: rnase hii from archaeoglobus fulgidus with cobalt hexammine chloride
Deposited on 2001-02-13, released 2001-04-11
The last revision prior to the SCOP 1.61 freeze date was dated 2001-04-11, with a file datestamp of 2001-04-11.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.223
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1i3aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3aA (A:)
    mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte
    vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl
    rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias
    gripscvrmrwktvsnlrqk