PDB entry 1i3a

View 1i3a on RCSB PDB site
Description: RNAse hii from archaeoglobus fulgidus with cobalt hexammine chloride
Class: hydrolase
Keywords: mixed beta sheet, helix-loop-helix, HYDROLASE
Deposited on 2001-02-13, released 2001-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.223
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hii
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: rnhB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i3aa_
  • Heterogens: NCO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i3aA (A:)
    mgsshhhhhhssglvprgshmkagideagkgcvigplvvagvacsdedrlrklgvkdskk
    lsqgrreelaeeirkicrtevlkvspenldermaaktineilkecyaeiilrlkpeiayv
    dspdviperlsreleeitglrvvaehkadekyplvaaasiiakverereierlkekfgdf
    gsgyasdprtrevlkewiasgripscvrmrwktvsnlrqktlddf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3aA (A:)
    mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte
    vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl
    rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias
    gripscvrmrwktvsnlrqk