PDB entry 1i39

View 1i39 on RCSB PDB site
Description: rnase hii from archaeoglobus fulgidus
Deposited on 2001-02-13, released 2001-04-11
The last revision prior to the SCOP 1.71 freeze date was dated 2001-04-11, with a file datestamp of 2001-04-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.244
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1i39a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i39A (A:)
    mgsshhhhhhssglvprgshmkagideagkgcvigplvvagvacsdedrlrklgvkdskk
    lsqgrreelaeeirkicrtevlkvspenldermaaktineilkecyaeiilrlkpeiayv
    dspdviperlsreleeitglrvvaehkadekyplvaaasiiakverereierlkekfgdf
    gsgyasdprtrevlkewiasgripscvrmrwktvsnlrqktlddf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i39A (A:)
    mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte
    vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl
    rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias
    gripscvrmrwktvsnlrqk