PDB entry 1i39

View 1i39 on RCSB PDB site
Description: RNAse hii from archaeoglobus fulgidus
Class: hydrolase
Keywords: mixed beta sheet, helix-loop-helix, HYDROLASE
Deposited on 2001-02-13, released 2001-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.244
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hii
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: rnhB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i39a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i39A (A:)
    mgsshhhhhhssglvprgshmkagideagkgcvigplvvagvacsdedrlrklgvkdskk
    lsqgrreelaeeirkicrtevlkvspenldermaaktineilkecyaeiilrlkpeiayv
    dspdviperlsreleeitglrvvaehkadekyplvaaasiiakverereierlkekfgdf
    gsgyasdprtrevlkewiasgripscvrmrwktvsnlrqktlddf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i39A (A:)
    mkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaeeirkicrte
    vlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsreleeitgl
    rvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtrevlkewias
    gripscvrmrwktvsnlrqk