PDB entry 1i35

View 1i35 on RCSB PDB site
Description: solution structure of the ras-binding domain of the protein kinase byr2 from schizosaccharomyces pombe
Class: transferase
Keywords: Ubiquitin superfold, TRANSFERASE
Deposited on 2001-02-13, released 2001-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase byr2
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: BYR2 (AMINO ACIDS 71 - 165)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i35a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i35A (A:)
cilrfiacngqtravqsrgdyqktlaialkkfsledaskfivcvsqssrikliteeefkq
icfnsssperdrliivpkekpcpsfedlrrsweie