PDB entry 1i35

View 1i35 on RCSB PDB site
Description: solution structure of the ras-binding domain of the protein kinase byr2 from schizosaccharomyces pombe
Deposited on 2001-02-13, released 2001-12-12
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1i35a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i35A (A:)
    cilrfiacngqtravqsrgdyqktlaialkkfsledaskfivcvsqssrikliteeefkq
    icfnsssperdrliivpkekpcpsfedlrrsweie