PDB entry 1i30

View 1i30 on RCSB PDB site
Description: E. Coli Enoyl Reductase +NAD+SB385826
Class: oxidoreductase
Keywords: enoyl reductase, acp, antibiotic, OXIDOREDUCTASE
Deposited on 2001-02-12, released 2002-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i30a_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i30b_
  • Heterogens: NAD, 826, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i30A (A:)
    mgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdiv
    lqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdis
    sysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpe
    gvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagi
    sgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i30A (A:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagisgevvhvdg
    gfsiaamn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i30B (B:)
    mgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdiv
    lqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdis
    sysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpe
    gvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagi
    sgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i30B (B:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagisgevvhvdg
    gfsiaamn