PDB entry 1i2v

View 1i2v on RCSB PDB site
Description: nmr solution structures of an antifungal and antibacterial mutant of heliomicin
Class: antimicrobial protein
Keywords: alpha-beta protein, CSab motif (cysteine stabilized alpha-helix beta-sheet motif), ANTIMICROBIAL PROTEIN
Deposited on 2001-02-12, released 2002-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: defensin heliomicin
  Species: Heliothis virescens [TaxId:7102]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81544 (0-43)
    • engineered (22-23)
  Domains in SCOPe 2.07: d1i2va_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i2vA (A:)
  dkligscvwgavnytsdcngecllrgykgghcgsfanvncwcet