PDB entry 1i2v

View 1i2v on RCSB PDB site
Description: nmr solution structures of an antifungal and antibacterial mutant of heliomicin
Deposited on 2001-02-12, released 2002-02-12
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-12, with a file datestamp of 2002-02-12.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1i2va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i2vA (A:)
    dkligscvwgavnytsdcngecllrgykgghcgsfanvncwcet