PDB entry 1i2m

View 1i2m on RCSB PDB site
Description: ran-rcc1-so4 complex
Deposited on 2001-02-11, released 2001-05-02
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.192
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1i2ma_
  • Chain 'B':
    Domains in SCOP 1.59: d1i2mb_
  • Chain 'C':
    Domains in SCOP 1.59: d1i2mc_
  • Chain 'D':
    Domains in SCOP 1.59: d1i2md_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i2mA (A:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i2mA (A:)
    qvqfklvlvgdggtgkttfvkrhlkkyvatlgvevhplvfhtnrgpikfnvwdtagqekf
    gglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikdrkvk
    aksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i2mB (B:)
    kvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtvcls
    ksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrvflw
    gsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcgeqgq
    lgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcgayftfaisheghvyg
    fglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgraey
    grlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtgqde
    dawspvemmgkqlenrvvlsvssggqhtvllvkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i2mB (B:)
    kvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtvcls
    ksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrvflw
    gsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcgeqgq
    lgrvpelfanrggrqglerllvpkcvmlkhvrfqdafcgayftfaisheghvygfglsny
    hqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgraeygrlglg
    egaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtgqdedawspv
    emmgkqlenrvvlsvssggqhtvllvkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i2mC (C:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i2mC (C:)
    qvqfklvlvgdggtgkttfvkrhlkyvatlgvevhplvfhtnrgpikfnvwdtagqekfg
    glrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikdrkvka
    ksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i2mD (D:)
    kvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtvcls
    ksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrvflw
    gsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcgeqgq
    lgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcgayftfaisheghvyg
    fglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgraey
    grlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtgqde
    dawspvemmgkqlenrvvlsvssggqhtvllvkdke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i2mD (D:)
    kvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtvcls
    ksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrvflw
    gsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcgeqgq
    lgrvpelfanrggrqglerllvpkcvmlkhvrfqdafcgayftfaisheghvygfglsny
    hqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgraeygrlglg
    egaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtgqdedawspv
    emmgkqlenrvvlsvssggqhtvllvkdke