PDB entry 1i2h

View 1i2h on RCSB PDB site
Description: crystal structure analysis of psd-zip45(homer1c/vesl-1l)conserved homer 1 domain
Class: signaling protein
Keywords: ENABLED VASP HOMOLOGY 1 domain, SIGNALING PROTEIN
Deposited on 2001-02-09, released 2002-05-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: psd-zip45(homer-1c/vesl-1l)
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PSD-ZIP45
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z214 (5-End)
      • see remark 999 (3-4)
    Domains in SCOPe 2.06: d1i2ha1, d1i2ha2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i2hA (A:)
    gspefmgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgska
    iinstitpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlake
    ksqekmeltstpsqesaggdlqspltpesingtddertpdvtqnsepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i2hA (A:)
    efmgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiin
    stitpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlakeksk
    meltstpsgdlqspltpe