PDB entry 1i26

View 1i26 on RCSB PDB site
Description: solution structure of ptu-1, a toxin from the assassin bugs peirates turpis that blocks the voltage sensitive calcium channel n-type
Deposited on 2001-02-06, released 2001-11-21
The last revision prior to the SCOP 1.71 freeze date was dated 2001-11-21, with a file datestamp of 2001-11-21.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1i26a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i26A (A:)
    aekdciapgapcfgtdkpccnprawcssyankcl