PDB entry 1i26

View 1i26 on RCSB PDB site
Description: solution structure of ptu-1, a toxin from the assassin bugs peirates turpis that blocks the voltage sensitive calcium channel n-type
Class: toxin
Keywords: Ca channel, assassin bug, TOXIN
Deposited on 2001-02-06, released 2001-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ptu-1
    Species: Peirates turpis [TaxId:181095]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i26a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i26A (A:)
    aekdciapgapcfgtdkpccnprawcssyankcl