PDB entry 1i24

View 1i24 on RCSB PDB site
Description: high resolution crystal structure of the wild-type protein sqd1, with nad and udp-glucose
Class: biosynthetic protein
Keywords: sdr, short-chain dehydrogenase/reductase, rossmann fold
Deposited on 2001-02-05, released 2003-07-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-07-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.192
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfolipid biosynthesis protein sqd1
    Species: Arabidopsis thaliana
    Gene: SQD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O48917 (12-End)
      • his tag (10-11)
    Domains in SCOP 1.75: d1i24a_
  • Heterogens: SO4, NAD, UPG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i24A (A:)
    mrgshhhhhhgsrvmviggdgycgwatalhlskknyevcivdnlvrrlfdhqlglesltp
    iasihdrisrwkaltgksielyvgdicdfeflaesfksfepdsvvhfgeqrsapysmidr
    sravytqhnnvigtlnvlfaikefgeechlvklgtmgeygtpnidieegyitithngrtd
    tlpypkqassfyhlskvhdshniaftckawgiratdlnqgvvygvktdetemheelrnrl
    dydavfgtalnrfcvqaavghpltvygkggqtrgyldirdtvqcveiaianpakagefrv
    fnqfteqfsvnelaslvtkagsklgldvkkmtvpnprveaeehyynakhtklmelgleph
    ylsdslldsllnfavqfkdrvdtkqimpsvswkkigvktksmtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i24A (A:)
    gsrvmviggdgycgwatalhlskknyevcivdnlvrrlfdhqlglesltpiasihdrisr
    wkaltgksielyvgdicdfeflaesfksfepdsvvhfgeqrsapysmidrsravytqhnn
    vigtlnvlfaikefgeechlvklgtmgeygtpnidieegyitithngrtdtlpypkqass
    fyhlskvhdshniaftckawgiratdlnqgvvygvktdetemheelrnrldydavfgtal
    nrfcvqaavghpltvygkggqtrgyldirdtvqcveiaianpakagefrvfnqfteqfsv
    nelaslvtkagsklgldvkkmtvpnprveaeehyynakhtklmelglephylsdslldsl
    lnfavqfkdrvdtkqimpsvswkkigvktksmt