PDB entry 1i22

View 1i22 on RCSB PDB site
Description:
Deposited on 2001-02-05, released 2001-02-28
The last revision prior to the SCOP 1.63 freeze date was dated 2001-02-28, with a file datestamp of 2001-02-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1i22a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1i22b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1i22c_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1i22d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i22A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscskllddniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i22B (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscskllddniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i22C (C:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscskllddniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i22D (D:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscskllddniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv