PDB entry 1i22

View 1i22 on RCSB PDB site
Description: mutant human lysozyme (a83k/q86d/a92d)
Class: hydrolase
Keywords: calcium binding site, mutant human lysozyme, hydrolase
Deposited on 2001-02-05, released 2001-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (82)
      • engineered (85)
      • engineered (91)
    Domains in SCOPe 2.07: d1i22a_
  • Chain 'B':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (82)
      • engineered (85)
      • engineered (91)
    Domains in SCOPe 2.07: d1i22b_
  • Chain 'C':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (82)
      • engineered (85)
      • engineered (91)
    Domains in SCOPe 2.07: d1i22c_
  • Chain 'D':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (82)
      • engineered (85)
      • engineered (91)
    Domains in SCOPe 2.07: d1i22d_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i22A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscskllddniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i22B (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscskllddniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i22C (C:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscskllddniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i22D (D:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscskllddniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv