PDB entry 1i20

View 1i20 on RCSB PDB site
Description: mutant human lysozyme (a92d)
Class: hydrolase
Keywords: calcium binding site, mutant human lysozyme, hydrolase
Deposited on 2001-02-05, released 2001-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2002-12-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.164
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (91)
    Domains in SCOP 1.75: d1i20a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i20A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniaddvacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv