PDB entry 1i1z

View 1i1z on RCSB PDB site
Description: mutant human lysozyme (q86d)
Class: hydrolase
Keywords: calcium binding site, mutant human lysozyme, hydrolase
Deposited on 2001-02-05, released 2001-02-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (85)
    Domains in SCOPe 2.03: d1i1za_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i1zA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallddniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv