PDB entry 1i1w

View 1i1w on RCSB PDB site
Description: 0.89A Ultra high resolution structure of a Thermostable Xylanase from Thermoascus Aurantiacus
Class: hydrolase
Keywords: xylan degradation, hydrolase, glycosidase, enzyme, ultra high resolution, cryo temperature, 1, 4-beta-xylan xylanohydrolase
Deposited on 2001-02-04, released 2003-01-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 0.89 Å
R-factor: 0.09
AEROSPACI score: 1.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Thermoascus aurantiacus [TaxId:5087]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23360 (0-302)
      • conflict (38)
      • conflict (192)
      • conflict (258)
      • conflict (299)
    Domains in SCOPe 2.05: d1i1wa_
  • Heterogens: UNX, GOL, EOH, ACN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i1wA (A:)
    eaaqsvdqlikargkvyfgvatdqnrlttgknaaiiqanfgqvtpensmkwdatepsqgn
    fnfagadylvnwaqqngklirghtlvwhsqlpswvssitdkntltnvmknhittlmtryk
    gkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsas
    ypktqaivnrvkkwraagvpidgigsqthlsagqgasvlqalpllasagtpevaiteldv
    agasstdyvnvvnaclnvsscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqn
    lqq