PDB entry 1i1r

View 1i1r on RCSB PDB site
Description: crystal structure of a cytokine/receptor complex
Deposited on 2001-02-02, released 2001-03-28
The last revision prior to the SCOP 1.71 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i1rA (A:)
    elldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytii
    nrtassvtftdiaslniqltcniltfgqleqnvygitiisglppekpknlscivnegkkm
    rcewdggrethletnftlksewathkfadckakrdtptsctvdystvyfvnievwveaen
    algkvtsdhinfdpvykvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyr
    tkdastwsqippedtastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgity
    edr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1rA (A:)
    lldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytiin
    rtassvtftdiaslniqltcniltfgqleqnvygitiisglppekpknlscivnegkkmr
    cewdggrethletnftlksewathkfadckakrdtptsctvdystvyfvnievwveaena
    lgkvtsdhinfdpvykvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrt
    kdastwsqippedtastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgitye
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i1rB (B:)
    lpdapefekdlliqrlnwmlwvidecfrdlcyrtgickgilepaaifhlklpaindtdhc
    gligfnetsclkkladgffefevlfkflttefgksvinvdvmelltktlgwdiqeelnkl
    tkthysppkfdrgllgrlqglkywvrhfasfyvlsamekfagqavrvldsipdvtpdvhd
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1rB (B:)
    efekdlliqrlnwmlwvidecfrdlcyrtgickgilepaaifhlklpaindtdhcgligf
    netsclkkladgffefevlfkflttefgksvinvdvmelltktlgwdiqeelnkltkthy
    sppkfdrgllgrlqglkywvrhfasfyvlsamekfagqavrvldsip