PDB entry 1i1r

View 1i1r on RCSB PDB site
Description: crystal structure of a cytokine/receptor complex
Class: cytokine
Keywords: cytokine/receptor complex, gp130, viral IL-6, crystal structure
Deposited on 2001-02-02, released 2001-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-6 receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i1ra1, d1i1ra2, d1i1ra3
  • Chain 'B':
    Compound: viral il-6
    Species: Human herpesvirus 8 [TaxId:37296]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i1rb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i1rA (A:)
    elldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytii
    nrtassvtftdiaslniqltcniltfgqleqnvygitiisglppekpknlscivnegkkm
    rcewdggrethletnftlksewathkfadckakrdtptsctvdystvyfvnievwveaen
    algkvtsdhinfdpvykvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyr
    tkdastwsqippedtastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgity
    edr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1rA (A:)
    lldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytiin
    rtassvtftdiaslniqltcniltfgqleqnvygitiisglppekpknlscivnegkkmr
    cewdggrethletnftlksewathkfadckakrdtptsctvdystvyfvnievwveaena
    lgkvtsdhinfdpvykvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrt
    kdastwsqippedtastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgitye
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i1rB (B:)
    lpdapefekdlliqrlnwmlwvidecfrdlcyrtgickgilepaaifhlklpaindtdhc
    gligfnetsclkkladgffefevlfkflttefgksvinvdvmelltktlgwdiqeelnkl
    tkthysppkfdrgllgrlqglkywvrhfasfyvlsamekfagqavrvldsipdvtpdvhd
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1rB (B:)
    efekdlliqrlnwmlwvidecfrdlcyrtgickgilepaaifhlklpaindtdhcgligf
    netsclkkladgffefevlfkflttefgksvinvdvmelltktlgwdiqeelnkltkthy
    sppkfdrgllgrlqglkywvrhfasfyvlsamekfagqavrvldsip