PDB entry 1i1j

View 1i1j on RCSB PDB site
Description: structure of melanoma inhibitory activity protein: a member of a new family of secreted proteins
Class: hormone/growth factor
Keywords: SH3 subdomain, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2001-02-02, released 2001-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.209
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: melanoma derived growth regulatory protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i1ja_
  • Chain 'B':
    Compound: melanoma derived growth regulatory protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i1jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i1jA (A:)
    mgpmpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlf
    wggsvqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfycq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1jA (A:)
    gpmpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlfw
    ggsvqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfyc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i1jB (B:)
    mgpmpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlf
    wggsvqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfycq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1jB (B:)
    mpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlfwgg
    svqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfyc