PDB entry 1i1h

View 1i1h on RCSB PDB site
Description: crystal structure analysis of precorrin-8x methylmutase complex with hydrogenobyrinic acid
Class: isomerase
Keywords: Precorrin, Vitamin B12, ISOMERASE
Deposited on 2001-02-01, released 2001-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.227
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: precorrin-8x methylmutase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Gene: COBH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i1ha_
  • Heterogens: COJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i1hA (A:)
    mrgshhhhhhpeydyirdgnaiyersfaiiraeadlsrfseeeadlavrmvhacgsveat
    rqfvfspdfvssaraalkagapilcdaemvahgvtrarlpagnevictlrdprtpalaae
    igntrsaaalklwserlagsvvaignaptalffllemlrdgapkpaailgmpvgfvgaae
    skdalaensygvpfaivrgrlggsamtaaalnslarpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1hA (A:)
    peydyirdgnaiyersfaiiraeadlsrfseeeadlavrmvhacgsveatrqfvfspdfv
    ssaraalkagapilcdaemvahgvtrarlpagnevictlrdprtpalaaeigntrsaaal
    klwserlagsvvaignaptalffllemlrdgapkpaailgmpvgfvgaaeskdalaensy
    gvpfaivrgrlggsamtaaalnslarpgl