PDB entry 1i1g

View 1i1g on RCSB PDB site
Description: crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus
Deposited on 2001-02-01, released 2002-02-06
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.316
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i1gA (A:)
    iderdkiileilekdartpfteiakklgisetavrkrvkaleekgiiegytikinpkklg
    yslvtitgvdtkpeklfevaeklkeydfvkelylssgdhmimaviwakdgedlaeiisnk
    igkiegvtkvcpaiileklk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i1gB (B:)
    iderdkiileilekdartpfteiakklgisetavrkrvkaleekgiiegytikinpkklg
    yslvtitgvdtkpeklfevaeklkeydfvkelylssgdhmimaviwakdgedlaeiisnk
    igkiegvtkvcpaiileklk