PDB entry 1i1d

View 1i1d on RCSB PDB site
Description: crystal structure of yeast gna1 bound to coa and glnac-6p
Class: transferase
Keywords: alpha/beta, domain swapping, gnat conserved core, transferase
Deposited on 2001-02-01, released 2001-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine-phosphate n-acetyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFL017C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43577 (2-160)
      • engineered (40)
    Domains in SCOPe 2.06: d1i1da_
  • Chain 'B':
    Compound: glucosamine-phosphate n-acetyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFL017C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43577 (Start-160)
      • engineered (40)
    Domains in SCOPe 2.06: d1i1db_
  • Chain 'C':
    Compound: glucosamine-phosphate n-acetyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFL017C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43577 (2-160)
      • cloning artifact (1)
      • engineered (40)
    Domains in SCOPe 2.06: d1i1dc1, d1i1dc2
  • Chain 'D':
    Compound: glucosamine-phosphate n-acetyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFL017C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43577 (2-160)
      • cloning artifact (0-1)
      • engineered (40)
    Domains in SCOPe 2.06: d1i1dd1, d1i1dd2
  • Heterogens: 16G, COA, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i1dA (A:)
    gsmslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkk
    imqynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidq
    lvtigfdygcykiildcdeknvkfyekcgfsnagvemqirk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1dA (A:)
    mslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndkkimqyn
    pmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvtig
    fdygcykiildcdeknvkfyekcgfsnagvemqirk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i1dB (B:)
    gsmslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkk
    imqynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidq
    lvtigfdygcykiildcdeknvkfyekcgfsnagvemqirk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1dB (B:)
    lpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndkkimqynpm
    vivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvtigfd
    ygcykiildcdeknvkfyekcgfsnagvemqirk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i1dC (C:)
    gsmslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkk
    imqynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidq
    lvtigfdygcykiildcdeknvkfyekcgfsnagvemqirk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1dC (C:)
    smslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwnkimqynp
    mvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvtigf
    dygcykiildcdeknvkfyekcgfsnagvemqirk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i1dD (D:)
    gsmslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkk
    imqynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidq
    lvtigfdygcykiildcdeknvkfyekcgfsnagvemqirk