PDB entry 1i18

View 1i18 on RCSB PDB site
Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli
Class: transferase
Keywords: greek-key-barrel, transferase
Deposited on 2001-01-31, released 2001-09-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: riboflavin synthase alpha chain
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29015 (0-96)
  Domains in SCOPe 2.02: d1i18a_
• Chain 'B':
  Compound: riboflavin synthase alpha chain
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29015 (0-96)
  Domains in SCOPe 2.02: d1i18b_
• Heterogens: RBF

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i18A (A:)
  mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
  fdlmketlritnlgdlkvgdwvnveraakfsdeiggh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i18B (B:)
  mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
  fdlmketlritnlgdlkvgdwvnveraakfsdeiggh