PDB entry 1i17

View 1i17 on RCSB PDB site
Description: nmr structure of mouse doppel 51-157
Class: unknown function
Keywords: mouse doppel, doppel, dpl, prion, UNKNOWN FUNCTION
Deposited on 2001-01-31, released 2001-03-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: prion-like protein
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QUG3 (0-106)
  Domains in SCOPe 2.01: d1i17a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i17A (A:)
  rvaenrpgafikqgrkldidfgaegnryyaanywqfpdgiyyegcseanvtkemlvtscv
  natqaanqaefsrekqdsklhqrvlwrlikeicsakhcdfwlergaa